제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human EGFR mAb (A24267)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Confocal imaging of A-431 cells using ABflo® 594 Rabbit anti-Human EGFR mAb (A24267, dilution 1:25). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - ABflo® 594 Rabbit anti-Human EGFR mAb (A24267)

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and A-431 cells (right) were surface-stained with ABflo® 594 Rabbit anti-Human EGFR mAb(A24267, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 A-431 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human EGFR mAb(A24267, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human EGFR mAb
Catalog No.	A24267
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61443-ABflo594

Background

The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 335-525 of human EGFR(NP_005219.2).
Sequence	KVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVS
Gene ID
Swiss Prot
Synonyms	EGFR; ERBB; ERBB1; HER1; NISBD2; PIG61; mENA; epidermal growth factor receptor
Calculated MW	44kDa/69kDa/77kDa/134kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Cell membrane, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus membrane, Nucleus membrane, Nucleus, Secreted, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 594 Rabbit anti-Human EGFR mAb images

Immunofluorescence - ABflo® 594 Rabbit anti-Human EGFR mAb (A24267)

Confocal imaging of A-431 cells using ABflo® 594 Rabbit anti-Human EGFR mAb (A24267, dilution 1:25). DAPI was used for nuclear staining (Blue). Objective: 100x.

Flow CytoMetry - ABflo® 594 Rabbit anti-Human EGFR mAb (A24267)

Flow cytometry:1X10^6 A-431 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human EGFR mAb(A24267, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.