제품 > 항체 > 단일클론항체(mAb)

ABflo® 450 Rabbit anti-Human EGFR mAb (A26808)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and A-431 cells (right) were surface-stained with ABflo® 450 Rabbit anti-Human EGFR mAb (A26808, 5 μl/Test, orange line) or ABflo® 450 Rabbit IgG isotype control (5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 A-431 cells were surface-stained with ABflo® 450 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 450 Rabbit anti-Human EGFR mAb (A26808, 5 μl/Test, right).

Overview

Product name	ABflo® 450 Rabbit anti-Human EGFR mAb
Catalog No.	A26808
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61443-ABflo450

Background

The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 335-525 of human EGFR (NP_005219.2).
Sequence	KVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVS
Gene ID
Swiss Prot
Synonyms	ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2
Calculated MW	44kDa/69kDa/77kDa/134kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus membrane, Nucleus membrane, Nucleus, Secreted, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 450 Rabbit anti-Human EGFR mAb images

Flow CytoMetry - ABflo® 450 Rabbit anti-Human EGFR mAb (A26808)

Flow cytometry: 1X10^6 A-431 cells were surface-stained with ABflo® 450 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 450 Rabbit anti-Human EGFR mAb (A26808, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.