제품 > 항체 > 단일클론항체(mAb)

APC/Cyanine7 Rabbit anti-Human EGFR mAb (A26582)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and A-431 cells (right) were surface-stained with APC/Cyanine7 Rabbit anti-Human EGFR mAb (A26582, 5 μl/Test, orange line) or APC/Cyanine7 Rabbit IgG isotype control (5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 A-431 cells were surface-stained with APC/Cyanine7 Rabbit IgG isotype control (5 μl/Test, left) or APC/Cyanine7 Rabbit anti-Human EGFR mAb (A26582, 5 μl/Test, right).

Overview

Product name	APC/Cyanine7 Rabbit anti-Human EGFR mAb
Catalog No.	A26582
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61443-APC-Cy7

Background

The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 335-525 of human EGFR(NP_005219.2).
Sequence	KVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVS
Gene ID
Swiss Prot
Synonyms	ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2
Calculated MW	44kDa/69kDa/77kDa/134kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus membrane, Nucleus membrane, Nucleus, Secreted, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

APC/Cyanine7 Rabbit anti-Human EGFR mAb images

Flow CytoMetry - APC/Cyanine7 Rabbit anti-Human EGFR mAb (A26582)

Flow cytometry: 1X10^6 A-431 cells were surface-stained with APC/Cyanine7 Rabbit IgG isotype control (5 μl/Test, left) or APC/Cyanine7 Rabbit anti-Human EGFR mAb (A26582, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.