제품 > 항체 > 아세틸화 특이적 항체

Acetyl-Histone H4-K12 Rabbit mAb (A22099)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1 μg Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb antibody (A22099) , along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of Acetyl-Histone H4-K5/K8/K12/K16 in representative gene loci (RPL30), as shown in figure.

ABclonal:Western blot - Acetyl-Histone H4-K12 Rabbit mAb (A22099)

Western blot analysis of various lysates, using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A20735) at1:20000 dilution. HeLa, C2C12 and C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Dot Blot - Acetyl-Histone H4-K12 Rabbit mAb (A22099)

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K5/K8/K12/K16 antibody (A22099) at 1:7000 dilution.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K12 Rabbit mAb (A22099)

Immunohistochemistry analysis of paraffin-embedded Human breast tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Acetyl-Histone H4-K12 Rabbit mAb (A22099)

Immunofluorescence analysis of HeLa treated by TSA and HeLa cells using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Chromatin Immunoprecipitation - Acetyl-Histone H4-K12 Rabbit mAb (A22099)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb antibody (A22099) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	Acetyl-Histone H4-K12 Rabbit mAb
Catalog No.	A22099
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54033

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.

Immunogen information

Immunogen	A synthetic acetylated peptide around K5/K8/K12/K16 of human Histone H4.
Sequence	MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID
Swiss Prot
Synonyms	H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Acetyl-Histone H4-K5/K8/K12/K16
Calculated MW	11kDa
Observed MW	11kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:20000 DB 1:2000 - 1:8000 IHC-P 1:100 - 1:500 IF/ICC 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 5μg-10μg of Chromatin CUT&Tag 10⁵ cells /1 μg
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Hele treated by TSA, C2C12 treated by TSA, C6 treated by TSA
Cellular location	Chromosome, Nucleus.
Customer validation	WB(Homo sapiens)