제품 > 항체 > 메틸화 특이적 항체

Symmetric DiMethyl-Histone H4-R3 Rabbit mAb (A26243)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Dot-blot analysis of H3R2me0、H3R2me1、H3R2me2a、H3R2me2s、H3R8me0、H3R8me1、H3R8me2a、H3R8me2s、H3R17me0、H3R17me1、H3R17me2a、H3R17me2s、H3R26me0、H3R26me1、H3R26me2a、H3R26me2s、H4R3me0、H4R3me1、H4R3me2a、H4R3me2s peptides using Symmetric DiMethyl-Histone H4-R3 Rabbit mAb (A26243) at 1:1000 dilution.

ABclonal:Western blot - Symmetric DiMethyl-Histone H4-R3 Rabbit mAb (A26243)

Western blot analysis of lysates from C6 cells using Symmetric DiMethyl-Histone H4-R3 Rabbit mAb (A26243) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - Symmetric DiMethyl-Histone H4-R3 Rabbit mAb (A26243)

Confocal imaging of U-2 OS cells using Symmetric DiMethyl-Histone H4-R3 Rabbit mAb (A26243, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Overview

Product name	Symmetric DiMethyl-Histone H4-R3 Rabbit mAb
Catalog No.	A26243
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66296

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4 (NP_003539.1).
Sequence	MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID
Swiss Prot
Synonyms	H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A
Calculated MW	11kDa
Observed MW	15kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	DB 1:500 - 1:1000 WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	C6
Cellular location	Extracellular exosome, extracellular region, nucleoplasm, nucleus.