제품 > 항체 > 메틸화 특이적 항체

DiMethyl-Histone H4-K20 Rabbit mAb (A22268)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Western blot analysis of various lysates, using DiMethyl-Histone H4-K20 Rabbit mAb (A22268) at1:120000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Dot Blot - DiMethyl-Histone H4-K20 Rabbit mAb (A22268)

Dot-blot analysis of all sorts of peptides using DiMethyl-Histone H4-K20 Rabbit mAb antibody (A22268) at 1:1000 dilution.

ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22268)

Immunohistochemistry analysis of paraffin-embedded Human cervix cancer using DiMethyl-Histone H4-K20 Rabbit mAb (A22268) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human spleen using DiMethyl-Histone H4-K20 Rabbit mAb (A22268) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat lung using DiMethyl-Histone H4-K20 Rabbit mAb (A22268) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - DiMethyl-Histone H4-K20 Rabbit mAb (A22268)

Immunofluorescence analysis of HeLa cells using DiMethyl-Histone H4-K20 Rabbit mAb (A22268) at dilution of 1:600(40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	DiMethyl-Histone H4-K20 Rabbit mAb
Catalog No.	A22268
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55058

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.

Immunogen information

Immunogen	A synthetic dimethylated peptide around K20 of human Histone H4 (NP_003539.1).
Sequence	MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID
Swiss Prot
Synonyms	H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20
Calculated MW	11kDa
Observed MW	11kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 DB 1:500 - 1:1000 IHC-P 1:500 - 1:1000 IF/ICC 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293F, NIH/3T3, C6
Cellular location	Chromosome, Nucleus.