Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Western blot analysis of various lysates, using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of various lysates, using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Dot-blot analysis of all sorts of methylation peptides using Symmetric DiMethyl-Histone H4-R3 antibody (A3159).
Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | Symmetric DiMethyl-Histone H4-R3 Rabbit pAb |
|---|---|
| Catalog No. | A3159 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4 (NP_003529.1). |
|---|---|
| Sequence | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Symmetric DiMethyl-Histone H4-R3 |
| Calculated MW | 11kDa |
| Observed MW | 15kDa |
| Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, C2C12, C6 |
| Cellular location | Chromosome, Nucleus. |
| Customer validation | WB(Rattus norvegicus, Mus musculus, Homo sapiens, Danio rerio) ChIP(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3159? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1721361071)
_WB_01.jpg?t=1721358065)
_WB_01.jpg?t=1715822831)
_WB_01.jpg?t=1715651707)
_WB_01.jpg?t=1713322500)
_WB_01.jpg?t=1715675057)
_WB_01.jpg?t=1713323103)
_WB_01.jpg?t=1721355659)
_WB_01.jpg?t=1718355783)
_WB_01.jpg?t=1716191102)
