제품 > 항체 > 단일클론항체(mAb)

[KD Validated] Bcl-2 Rabbit mAb (A21873)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and Bcl-2 knockdown (KD) 293T cells using [KD Validated] Bcl-2 Rabbit mAb (A21873) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 30s.

ABclonal:Immunohistochemistry - [KD Validated] Bcl-2 Rabbit mAb (A21873)

Immunohistochemistry analysis of paraffin-embedded Human follicular lymphoma tissue using [KD Validated] Bcl-2 Rabbit mAb (A21873) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human appendix tissue using [KD Validated] Bcl-2 Rabbit mAb (A21873) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KD Validated] Bcl-2 Rabbit mAb (A21873) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunoprecipitation - [KD Validated] Bcl-2 Rabbit mAb (A21873)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg [KD Validated] Bcl-2 Rabbit mAb (A21873). Western blot was performed from the immunoprecipitate using [KD Validated] Bcl-2 Rabbit mAb (A21873) at a dilution of 1:1000.

Overview

Product name	[KD Validated] Bcl-2 Rabbit mAb
Catalog No.	A21873
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2580

Background

This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bcl-2 (P10415).
Sequence	MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
Gene ID
Swiss Prot
Synonyms	Bcl-2; PPP1R50
Calculated MW	26kDa
Observed MW	26kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:200 - 1:800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	293T,
Cellular location	Endoplasmic reticulum membrane, Mitochondrion outer membrane, Nucleus membrane, Single-pass membrane protein.