Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | [KO Validated] EGFR Rabbit mAb |
---|---|
Catalog No. | A4929 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1138 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human EGFR (NP_005219.2). |
---|---|
Sequence | SINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGL |
Gene ID | |
Swiss Prot | |
Synonyms | ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2; FR |
Calculated MW | 134kDa |
Observed MW | 175kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa |
Cellular location | Cell membrane, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus membrane, Nucleus membrane, Nucleus, Secreted, Single-pass type I membrane protein. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4929? Please let us know so that we can cite the reference in this datasheet.