제품 > 항체 > 메틸화 특이적 항체

DiMethyl-Histone H3-K36 Rabbit mAb (A22087)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Western blot analysis of lysates from NIH/3T3 cells, using DiMethyl-Histone H3-K36 Rabbit mAb (A22087) at1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Dot Blot - DiMethyl-Histone H3-K36 Rabbit mAb (A22087)

Dot-blot analysis of all sorts of peptides using DiMethyl-Histone H3-K36 Rabbit mAb antibody (A22087) at 1:10000 dilution.

ABclonal:Immunohistochemistry - DiMethyl-Histone H3-K36 Rabbit mAb (A22087)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using DiMethyl-Histone H3-K36 Rabbit mAb (A22087) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human breast tissue using DiMethyl-Histone H3-K36 Rabbit mAb (A22087) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using DiMethyl-Histone H3-K36 Rabbit mAb (A22087) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using DiMethyl-Histone H3-K36 Rabbit mAb (A22087) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using DiMethyl-Histone H3-K36 Rabbit mAb (A22087) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using DiMethyl-Histone H3-K36 Rabbit mAb (A22087) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using DiMethyl-Histone H3-K36 Rabbit mAb (A22087) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using DiMethyl-Histone H3-K36 Rabbit mAb (A22087) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - DiMethyl-Histone H3-K36 Rabbit mAb (A22087)

Immunofluorescence analysis of C6 cells using DiMethyl-Histone H3-K36 Rabbit mAb (A22087) at dilution of 1:200/1:500 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of MCF7 cells using DiMethyl-Histone H3-K36 Rabbit mAb (A22087) at dilution of 1:200/1:500 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - DiMethyl-Histone H3-K36 Rabbit mAb (A22087)

Immunoprecipitation analysis of 600 μg extracts of 293F cells using 5 μg DiMethyl-Histone H3-K36 antibody (A22087). Western blot was performed from the immunoprecipitate using DiMethyl-Histone H3-K36 antibody (A22087) at a dilution of 1:10000.

Overview

Product name	DiMethyl-Histone H3-K36 Rabbit mAb
Catalog No.	A22087
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54175

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen	A synthetic dimethylated peptide around K36 of human Histone H3 (NP_003520.1).
Sequence	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID
Swiss Prot
Synonyms	H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36
Calculated MW	16kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:10000 DB 1:2000 - 1:10000 IHC-P 1:1000 - 1:5000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	NIH/3T3
Cellular location	Chromosome, Nucleus.
Customer validation	WB(Mus musculus)