Reviews (2)Publications (25) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Western blot analysis of various lysates using DiMethyl-Histone H3-K4 Rabbit pAb (A2356) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Dot-blot analysis of all sorts of methylation peptides using DiMethyl-Histone H3-K4 antibody (A2356).
Immunohistochemistry analysis of paraffin-embedded Rat testis using DiMethyl-Histone H3-K4 Rabbit pAb (A2356) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using DiMethyl-Histone H3-K4 Rabbit pAb (A2356) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast using DiMethyl-Histone H3-K4 Rabbit pAb (A2356) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of PC-12 cells using DiMethyl-Histone H3-K4 Rabbit pAb (A2356) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Chromatin immunoprecipitation was performed with 10 μg of cross-linked chromatin from HeLa cells, using 5.5 μg of DiMethyl-Histone H3-K4 Rabbit pAb (A2356) and Rabbit IgG isotype control (AC042). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.
| Product name | DiMethyl-Histone H3-K4 Rabbit pAb |
|---|---|
| Catalog No. | A2356 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). |
|---|---|
| Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4 |
| Calculated MW | 16kDa |
| Observed MW | 17kDa |
| Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, NIH/3T3, C6 |
| Cellular location | Chromosome, Nucleus. |
| Customer validation | (Penicillium oxalate, Human cells) WB(Rattus norvegicus, Homo sapiens, Mus musculus, Sac fungi , Penicillium oxalicum, Eurosta solidaginis, Oryza sativa, Saccharomyces cerevisiae) IHC(Homo sapiens) IF(Mus musculus) ChIP(Oryza sativa, Mus musculus, Homo sapiens) WB (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2356? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1721357921)
(Me)_WB_01.jpg?t=1721357762)
_WB_01.jpg?t=1718354328)
_WB_01.jpg?t=1721361058)
_WB_01.jpg?t=1721358100)
_WB_01.jpg?t=1721357979)
_WB_01.jpg?t=1713324721)
_WB_02.jpg?t=1715665068)
_WB_01.jpg?t=1715656137)
_WB_01.jpg?t=1715666785)
_WB_01.jpg?t=1721355725)
_WB_01.jpg?t=1721355883)
(P)_WB_01.jpg?t=1721813706)
_WB_01.jpg?t=1721361082)
_WB_01.jpg?t=1715066854)
(Me)_WB_02.jpg?t=1713324906)
_WB_01.jpg?t=1713324899)
_WB_01.jpg?t=1713322984)
_WB_01.jpg?t=1715677777)
(jia2)_WB_01.jpg?t=1718355663)
_IHC_01.jpg?t=1715132955)
(A)_WB_02.jpg?t=1721354870)
_WB_01.jpg?t=1715670501)
_WB_01.jpg?t=1721355613)
_WB_01.jpg?t=1721355870)
_WB_01.jpg?t=1721355876)
_WB_01.jpg?t=1713323210)
_WB_01.jpg?t=1715677480)
