Reviews (3)Publications (16) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Western blot analysis of various lysates, using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Dot-blot analysis of all sorts of methylation peptides using TriMethyl-Histone H3-K36 antibody (A2366).
Immunohistochemistry analysis of paraffin-embedded Human lung using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human spleen using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse lung using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat lung using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of 293T cells using TriMethyl-Histone H3-K36 Rabbit pAb (A2366). Blue: DAPI for nuclear staining.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TriMethyl-Histone H3-K36 Rabbit pAb antibody (A2366) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TriMethyl-Histone H3-K36 antibody (A2366) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Chromatin immunoprecipitation was performed with 5 μg of cross-linked chromatin from HeLa cells, using 5 μg of TriMethyl-Histone H3-K36 Rabbit pAb (A2366) and Rabbit IgG isotype control (AC042). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.
| Product name | TriMethyl-Histone H3-K36 Rabbit pAb |
|---|---|
| Catalog No. | A2366 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). |
|---|---|
| Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K36 |
| Calculated MW | 16kDa |
| Observed MW | 17kDa |
| Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | MCF7, C2C12, PC-12 |
| Cellular location | Chromosome, Nucleus. |
| Customer validation | (HEK293T, Hippocampus) IHC(Sus scrofa, Mus musculus) IF(Homo sapiens, Mus musculus) WB(Homo sapiens, Mus musculus, Eurosta solidaginis, Rattus norvegicus, Oryza sativa, Saccharomyces cerevisiae) IHC(Rattus norvegicus) ChIP(Oryza sativa) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2366? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1721357921)
(Me)_WB_01.jpg?t=1721357762)
_WB_01.jpg?t=1718354328)
_WB_01.jpg?t=1721361058)
_WB_01.jpg?t=1721358100)
_WB_01.jpg?t=1721357979)
_WB_01.jpg?t=1713324721)
_WB_02.jpg?t=1715665068)
_WB_01.jpg?t=1715656137)
_WB_01.jpg?t=1715666785)
_WB_01.jpg?t=1721355725)
_WB_01.jpg?t=1721355883)
(P)_WB_01.jpg?t=1721813706)
_WB_01.jpg?t=1721361082)
_WB_01.jpg?t=1715066854)
(Me)_WB_02.jpg?t=1713324906)
_WB_01.jpg?t=1713324899)
_WB_01.jpg?t=1713322984)
_WB_01.jpg?t=1715677777)
(jia2)_WB_01.jpg?t=1718355663)
_IHC_01.jpg?t=1715132955)
(A)_WB_02.jpg?t=1721354870)
_WB_01.jpg?t=1715670501)
_WB_01.jpg?t=1721355613)
_WB_01.jpg?t=1721355870)
_WB_01.jpg?t=1721355876)
_WB_01.jpg?t=1713323210)
_WB_01.jpg?t=1715677480)
