Reviews (3)Publications (16) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Product name | TriMethyl-Histone H3-K36 Rabbit pAb |
---|---|
Catalog No. | A2366 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). |
---|---|
Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
Gene ID | |
Swiss Prot | |
Synonyms | H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K36 |
Calculated MW | 16kDa |
Observed MW | 17kDa |
Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | MCF7, C2C12, PC-12 |
Cellular location | Chromosome, Nucleus. |
Customer validation | (HEK293T, Hippocampus) IHC(Sus scrofa, Mus musculus) IF(Homo sapiens, Mus musculus) WB(Homo sapiens, Mus musculus, Eurosta solidaginis, Rattus norvegicus, Oryza sativa, Saccharomyces cerevisiae) IHC(Rattus norvegicus) ChIP(Oryza sativa) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2366? Please let us know so that we can cite the reference in this datasheet.