Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Product name | MonoMethyl-Histone H3-K27 Rabbit mAb |
---|---|
Catalog No. | A22170 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC55261 |
Immunogen | A synthetic monomethylated peptide around K27 of human Histone H3 (NP_003520.1). |
---|---|
Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
Gene ID | |
Swiss Prot | |
Synonyms | H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K27 |
Calculated MW | 16kDa |
Observed MW | 17kDa |
Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa, NIH/3T3, C6 |
Cellular location | Chromosome, Nucleus. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.