제품 > 항체 > 메틸화 특이적 항체

MonoMethyl-Histone H3-K36 Rabbit mAb (A23944)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Western blot analysis of various lysates, using MonoMethyl-Histone H3-K36 Rabbit mAb (A23944) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): H3 protein
Exposure time: 60s.

ABclonal:Dot Blot - MonoMethyl-Histone H3-K36 Rabbit mAb (A23944)

Dot-blot analysis of all sorts of peptides using MonoMethyl-Histone H3-K36 Rabbit mAb (A23944) at 1:2000 dilution.

ABclonal:Immunoprecipitation - MonoMethyl-Histone H3-K36 Rabbit mAb (A23944)

Immunoprecipitation analysis of 600ug extracts of Hela cells using 5ug MonoMethyl-Histone H3-K36 Rabbit mAb (A23944). Western blot was performed from the immunoprecipitate using MonoMethyl-Histone H3-K36 Rabbit mAb (A23944) at a dilition of 1:5000.

ABclonal:Chromatin Immunoprecipitation - MonoMethyl-Histone H3-K36 Rabbit mAb (A23944)

Chromatin immunoprecipitation analysis of extracts of MCF7 cells, using MonoMethyl-Histone H3-K36 Rabbit mAb antibody (A23944) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	MonoMethyl-Histone H3-K36 Rabbit mAb
Catalog No.	A23944
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61490

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen	A synthetic monomethylated peptide around K36 of human histone H3 (NP_003520.1).
Sequence	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID
Swiss Prot
Synonyms	H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K36
Calculated MW	15kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 DB 1:1000 - 1:5000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 5μg-10μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, NIH/3T3
Cellular location	Chromosome, Nucleus.