Reviews (2)Publications (34) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Western blot analysis of lysates from HeLa cells, using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Dot-blot analysis of all sorts of methylation peptides using DiMethyl-Histone H3-K9 antibody (A2359).
Immunohistochemistry analysis of paraffin-embedded Human kidney using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of A-549 cells using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using DiMethyl-Histone H3-K9 antibody (A2359) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
| Product name | DiMethyl-Histone H3-K9 Rabbit pAb |
|---|---|
| Catalog No. | A2359 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). |
|---|---|
| Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K9 |
| Calculated MW | 16kDa |
| Observed MW | 17kDa |
| Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa |
| Cellular location | Chromosome, Nucleus. |
| Customer validation | (293FT,PC9, UBQ10) WB(Homo sapiens, Mus musculus, Zea mays, Lithobates sylvaticus, Eurosta solidaginis, Sus scrofa, Arabidopsis thaliana, Mus musculus) IHC(Homo sapiens) IHC(Arabidopsis thaliana) IF(Arabidopsis thaliana, Homo sapiens, Mus musculus) ChIP(Homo sapiens, Mus musculus, Sus scrofa, Mus musculus) IF(Homo sapiens) ChIP(Homo sapiens) DB(Homo sapiens) ChIP-Seq(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2359? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1721357921)
(Me)_WB_01.jpg?t=1721357762)
_WB_01.jpg?t=1718354328)
_WB_01.jpg?t=1721361058)
_WB_01.jpg?t=1721358100)
_WB_01.jpg?t=1721357979)
_WB_01.jpg?t=1713324721)
_WB_02.jpg?t=1715665068)
_WB_01.jpg?t=1715656137)
_WB_01.jpg?t=1715666785)
_WB_01.jpg?t=1721355725)
_WB_01.jpg?t=1721355883)
(P)_WB_01.jpg?t=1721813706)
_WB_01.jpg?t=1721361082)
_WB_01.jpg?t=1715066854)
(Me)_WB_02.jpg?t=1713324906)
_WB_01.jpg?t=1713324899)
_WB_01.jpg?t=1713322984)
_WB_01.jpg?t=1715677777)
(jia2)_WB_01.jpg?t=1718355663)
_IHC_01.jpg?t=1715132955)
(A)_WB_02.jpg?t=1721354870)
_WB_01.jpg?t=1715670501)
_WB_01.jpg?t=1721355613)
_WB_01.jpg?t=1721355870)
_WB_01.jpg?t=1721355876)
_WB_01.jpg?t=1713323210)
_WB_01.jpg?t=1715677480)
