Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Product name | TriMethyl-Histone H3-K9 Rabbit mAb |
---|---|
Catalog No. | A22295 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC54898 |
Immunogen | A synthetic trimethylated peptide around K9 of human Histone H3 (NP_003520.1). |
---|---|
Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
Gene ID | |
Swiss Prot | |
Synonyms | H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K9 |
Calculated MW | 15kDa |
Observed MW | 17kDa |
Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa, C2C12 , C6 |
Cellular location | Chromosome, Nucleus. |
Customer validation | ChIP(Sus scrofa) IF(Sus scrofa) WB(Sus scrofa) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22295? Please let us know so that we can cite the reference in this datasheet.