제품 > 항체 > 메틸화 특이적 항체

MonoMethyl-Histone H3-K36 Rabbit pAb (A2364)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Western blot analysis of various lysates using MonoMethyl-Histone H3-K36 Rabbit pAb (A2364) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Dot Blot - MonoMethyl-Histone H3-K36 Rabbit pAb (A2364)

Dot-blot analysis of all sorts of methylation peptides using MonoMethyl-Histone H3-K36 antibody (A2364).

ABclonal:Immunofluorescence - MonoMethyl-Histone H3-K36 Rabbit pAb (A2364)

Immunofluorescence analysis of 293T cells using MonoMethyl-Histone H3-K36 Rabbit pAb (A2364). Blue: DAPI for nuclear staining.

ABclonal:Chromatin Immunoprecipitation - MonoMethyl-Histone H3-K36 Rabbit pAb (A2364)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using MonoMethyl-Histone H3-K36 antibody (A2364) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Review

Overview

Product name	MonoMethyl-Histone H3-K36 Rabbit pAb
Catalog No.	A2364
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1).
Sequence	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID
Swiss Prot
Synonyms	H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K36
Calculated MW	16kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 6.5μg antibody for 5μg-10μg of Chromatin ChIP-seq 1:20 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, NIH/3T3, C6
Cellular location	Chromosome, Nucleus.
Customer validation	(HeLa, Hippocampus) WB(Homo sapiens, Mus musculus, Oryza sativa)