제품 > 항체 > 메틸화 특이적 항체

DiMethyl-Histone H3-K9 Rabbit mAb (A26196)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Dot-blot analysis of all sorts of peptides using DiMethyl-Histone H3-K9 Rabbit mAb.

ABclonal:Western blot - DiMethyl-Histone H3-K9 Rabbit mAb (A26196)

Western blot analysis of various lysates using DiMethyl-Histone H3-K9 Rabbit mAb (A26196) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): H3 prokaryotic protein
Exposure time: 30s.

ABclonal:Immunohistochemistry - DiMethyl-Histone H3-K9 Rabbit mAb (A26196)

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using DiMethyl-Histone H3-K9 Rabbit mAb (A26196) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using DiMethyl-Histone H3-K9 Rabbit mAb (A26196) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using DiMethyl-Histone H3-K9 Rabbit mAb (A26196) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using DiMethyl-Histone H3-K9 Rabbit mAb (A26196) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Chromatin Immunoprecipitation - DiMethyl-Histone H3-K9 Rabbit mAb (A26196)

Chromatin immunoprecipitation was performed with 10 μg of cross-linked chromatin from HeLa cells, using 3 μg of DiMethyl-Histone H3-K9 Rabbit mAb (A26196) and Rabbit IgG isotype control (AC042). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.

Review

Overview

Product name	DiMethyl-Histone H3-K9 Rabbit mAb
Catalog No.	A26196
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68260

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen	A synthetic dimethylated peptide around K9 of human Histone H3 (NP_003520.1).
Sequence	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID
Swiss Prot
Synonyms	H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K9
Calculated MW	16kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 DB 1:500 - 1:1000 IHC-P 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 2μg antibody for 5μg-10μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, NIH/3T3, C6, Wheat
Cellular location	Chromosome, Nucleus.
Customer validation	(Arabidopsis Seedlings)